PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 332aa    MW: 37137.3 Da    PI: 7.4141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +k++G g+W++ ++  g++R++k+c++rw +yl
   XP_009617932.1 14 KGPWTPEEDQKLINHIKKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.46.7e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia +++ gRt++++k++w+++l
   XP_009617932.1  67 RGKFSQEEEQTILNLHAILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.851961IPR017930Myb domain
SuperFamilySSF466896.36E-3211108IPR009057Homeodomain-like
SMARTSM007174.7E-161363IPR001005SANT/Myb domain
PfamPF002491.5E-171461IPR001005SANT/Myb domain
CDDcd001673.20E-131661No hitNo description
PROSITE profilePS5129427.18762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2865117IPR009057Homeodomain-like
SMARTSM007175.4E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667112IPR001005SANT/Myb domain
CDDcd001678.81E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRSPCCDEG GLKKGPWTPE EDQKLINHIK KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHAILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPMTHRPRT DIFNSLPHLI ALANLKELLV EQHHSSLEGQ AMRLQSEMAT LQYLHYLLQP  180
PPTTPNMADV EAYTLLNSMK DGQFISTNHL ENSLNNIPSI LPSSSLRAVQ DSIPFSHLPE  240
LQAPALCSNF QLTSLNNKEN MIQLSVLSRD DQNMTPTSSP WPPTSLSPSP RPPAAAAIND  300
INIAGDSNCS TSLFGGAWPE ILLEDSLFHD IP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754436e-57HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617932.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_016462191.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP07e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A068TZV31e-138A0A068TZV3_COFCA; Uncharacterized protein
STRINGSolyc04g056310.2.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.18e-99myb domain protein 93